MAPK4 Rabbit Polyclonal Antibody

CAT#: TA342151

Rabbit polyclonal Anti-MAPK4 Antibody

Product Images

WB Suggested Anti-MAPK4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MAPK4 antibody: synthetic peptide directed towards the middle region of human MAPK4. Synthetic peptide located within the following region: DFLEKILTFNPMDRLTAEMGLQHPYMSPYSCPEDEPTSQHPFRIEDEIDD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 66 kDa
• Gene Name: mitogen-activated protein kinase 4
• Database Link:
  NP_002738
  Entrez Gene 5596 Human
  UniProt ID P31152
• Background: Mitogen-activated protein kinase 4 is a member ofThe mitogen-activated protein kinase family. Tyrosine kinase growth factor receptors activate mitogen-activated protein kinases whichThen translocate intoThe nucleus and phosphorylate nuclear targets. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014]
• Synonyms: ERK-4; ERK4; p63-MAPK; p63MAPK; PRKM4
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase