NDUFS1 Rabbit Polyclonal Antibody

CAT#: TA342230

Rabbit polyclonal Anti-NDUFS1 Antibody

Product Images

Lanes: ; Lane 1: 30 ug Human liver; Lane 2: 30 ug Rat liver; Lane 3: 30 ug Mouse (wild-type) liver; Lane 4: 30 ug Mouse [AMPK alpha 1/2 (-/-)] liver; Lane 5: 30 ug Human muscle; Lane 6: 30 ug Rat muscle; Lane 7: 30 ug Mouse muscle; Primary Antibody Dilution: ; 1:

• 

  WB Suggested Anti-NDUFS1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Fetal Liver

• 

  nuclear lysates

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NDUFS1 antibody: synthetic peptide directed towards the middle region of human NDUFS1. Synthetic peptide located within the following region: TPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 77 kDa
• Gene Name: NADH:ubiquinone oxidoreductase core subunit S1
• Database Link:
  NP_004997
  Entrez Gene 227197 MouseEntrez Gene 301458 RatEntrez Gene 4719 Human
  UniProt ID P28331
• Background: The protein encoded byThis gene belongs toThe complex I 75 kDa subunit family. Mammalian complex I is composed of 45 different subunits. It locates atThe mitochondrial inner membrane.This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH toThe respiratory chain.The immediate electron acceptor forThe enzyme is believed to be ubiquinone.This protein isThe largest subunit of complex I and it is a component ofThe iron-sulfur (IP) fragment ofThe enzyme. It may form part ofThe active site crevice where NADH is oxidized. Mutations inThis gene are associated with complex I deficiency. Several transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Jan 2011]
• Synonyms: CI-75k; CI-75Kd; PRO1304
• Note: Immunogen Sequence Homology: Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Guinea pig: 93%; Zebrafish: 79%

Reference Data

• Protein Pathways: Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease