PDE1C Rabbit Polyclonal Antibody

CAT#: TA342232

Rabbit polyclonal Anti-PDE1C Antibody

Product Images

WB Suggested Anti-PDE1C Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PDE1C antibody: synthetic peptide directed towards the middle region of human PDE1C. Synthetic peptide located within the following region: IDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 72 kDa
• Gene Name: phosphodiesterase 1C
• Database Link:
  NP_005011
  Entrez Gene 5137 Human
  UniProt ID Q14123
• Background: Cyclic nucleotide phosphodiesterases (PDEs) catalyze hydrolysis ofThe cyclic nucleotides cAMP and cGMP toThe corresponding nucleoside 5-prime-monophosphates. Mammalian PDEs have been classified into several families based onTheir biochemical properties. Members ofThe PDE1 family, such as PDE1C, are calmodulin (see MIM 114180)-dependent PDEs (CaM-PDEs) that are stimulated by a calcium-calmodulin complex (Repaske et al., 1992 [PubMed 1326532]). [supplied by OMIM, Oct 2009]. Transcript Variant:This variant (1) differs inThe 5' and 3' UTR and has multiple coding region differences, compared to variant 3.These differences result in an isoform (1) with distinct N- and C-termini, compared to isoform 3. Variants 1 and 4 encodeThe same protein. Isoform 1 is also known as HCam-3B. Sequence Note:This RefSeq record was created from transcript and genomic sequence data to makeThe sequence consistent withThe reference genome assembly.The genomic coordinates used forThe transcript record were based on transcript alignments. Publication Note:This RefSeq record includes a subset ofThe publications that are available forThis gene. Please seeThe Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC022479.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete onThe 3' end.
• Synonyms: cam-PDE 1C; hCam-3; Hcam3
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Rabbit: 93%; Horse: 92%; Guinea pig: 92%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Calcium signaling pathway, Olfactory transduction, Progesterone-mediated oocyte maturation, Purine metabolism