T Plastin (PLS3) Rabbit Polyclonal Antibody

CAT#: TA342236

Rabbit polyclonal Anti-PLS3 Antibody

Product Images

WB Suggested Anti-PLS3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: HT1080 cell lysatePLS3 is supported by BioGPS gene expression data to be expressed in HT1080

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PLS3 antibody: synthetic peptide directed towards the middle region of human PLS3. Synthetic peptide located within the following region: RRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 71 kDa
• Gene Name: plastin 3
• Database Link:
  NP_005023
  Entrez Gene 5358 Human
  UniProt ID P13797
• Background: Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. Plastin 1 (otherwise known as Fimbrin) is a third distinct plastin isoform which is specifically expressed at high levels inThe small intestine.The L isoform is expressed only in hemopoietic cell lineages, whileThe T isoform has been found in all other normal cells of solid tissues that have replicative potential (fibroblasts, endothelial cells, epithelial cells, melanocytes, etc.).The C-terminal 570 amino acids ofThe T-plastin and L-plastin proteins are 83% identical. It contains a potential calcium-binding site nearThe N terminus. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Feb 2010]
• Synonyms: BMND18; T-plastin
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Yeast: 77%