Foxs1 Rabbit Polyclonal Antibody

CAT#: TA342258

Rabbit Polyclonal Anti-Foxs1 Antibody

Product Images

WB Suggested Anti-Fkhl18 Antibody Titration: 0.2-1 ug/ml; Positive Control: Mouse Brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Fkhl18 antibody: synthetic peptide directed towards the c terminal of mouse Fkhl18. Synthetic peptide located within the following region: MQTLNFCMGTDPGLEHLLVSSVPTPGSSTPSASHRAPLPLPADSKEPWVA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: forkhead box S1
• Database Link:
  NP_034356
  Entrez Gene 14239 Mouse
  UniProt ID Q61574
• Background: Fkhl18 is a transcriptional repressor that suppresses transcription from the FASLG, FOXO3 and FOXO4 promoters.Fkhl18 may have a role in the organization of the testicular vasculature.
• Synonyms: FKHL18; FREAC-10; FREAC10; MGC4544
• Note: Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Horse: 86%; Bovine: 86%; Pig: 79%; Guinea pig: 79%