AGXT2L2 (PHYKPL) Rabbit Polyclonal Antibody

CAT#: TA342504

Rabbit Polyclonal Anti-AGXT2L2 Antibody

Product Images

WB Suggested Anti-AGXT2L2 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AGXT2L2 antibody: synthetic peptide directed towards the C terminal of human AGXT2L2. Synthetic peptide located within the following region: KIKHPIVGDVRGVGLFIGVDLIKDEATRTPATEEAAYLVSRLKENYVLLS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: 5-phosphohydroxy-L-lysine phospho-lyase
• Database Link:
  NP_699204
  Entrez Gene 85007 Human
  UniProt ID Q8IUZ5
• Background: This is a nuclear gene encoding a mitochondrial enzyme that catalyzes the conversion of 5-phosphonooxy-L-lysine to ammonia, inorganic phosphate, and 2-aminoadipate semialdehyde. Mutations in this gene may cause phosphohydroxylysinuria. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2013]
• Synonyms: AGXT2L2; PHLU
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 92%; Rat: 92%; Horse: 92%; Bovine: 92%; Rabbit: 92%; Mouse: 85%; Guinea pig: 85%

Reference Data

• Protein Families: Druggable Genome