NDRG2 Rabbit Polyclonal Antibody

CAT#: TA342552

Rabbit Polyclonal Anti-Ndrg2 Antibody

Product Images

WB Suggested Anti-Ndrg2 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Ndrg2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TEEKPLLPGQTPETAKEAELAARILLDQGQTHSVETPYGSVTFTVYGTPK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: NDRG family member 2
• Database Link:
  NP_057334
  Entrez Gene 29811 Mouse
  UniProt ID Q9UN36
• Background: Contributes to the regulation of the Wnt signaling pathway. Down-regulates CTNNB1-mediated transcriptional activation of target genes, such as CCND1, and may thereby act as tumor suppressor. May be involved in dendritic cell and neuron differentiation.
• Synonyms: SYLD
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Rabbit: 93%