AIMP2 Rabbit Polyclonal Antibody

CAT#: TA342584

Rabbit Polyclonal Anti-AIMP2 Antibody

Product Images

WB Suggested Anti-AIMP2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: MCF7 cell lysateAIMP2 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AIMP2 antibody: synthetic peptide directed towards the N terminal of human AIMP2. Synthetic peptide located within the following region: SLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: aminoacyl tRNA synthetase complex interacting multifunctional protein 2
• Database Link:
  NP_006294
  Entrez Gene 7965 Human
  UniProt ID Q13155
• Background: The JTV1 gene is located on chromosome 7p22 flanked by two genes, HRI and PMS2. JTV1 and HRI overlap slightly and are arranged in a tail-to-tail fashion. JTV1 and PMS2 are separated by approximately 200 base pairs and are arranged head-to-head. JTV1 is transcribed in the opposite direction compared to HRI and PMS2. The function of the JTV1 gene product is unknown.
• Synonyms: JTV-1; JTV1; P38; PRO0992
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Guinea pig: 100%; Bovine: 93%; Rabbit: 93%

Reference Data

• Protein Families: Stem cell - Pluripotency