CENPU Rabbit Polyclonal Antibody

CAT#: TA342608

Rabbit Polyclonal Anti-CENPU Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "CENPU"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MLF1IP antibody is: synthetic peptide directed towards the N-terminal region of Human MLF1IP. Synthetic peptide located within the following region: IYADEEEFSKHCGLSLSSTPPGKEAKRSSDTSGNEASEIESVKISAKKPG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 35 kDa
Gene Name centromere protein U
Background The function of this protein remains unknown.
Synonyms CENP50; CENPU50; KLIP1; MLF1IP; PBIP1
Note Immunogen Sequence Homology: Human: 100%; Bovine: 86%; Pig: 79%; Horse: 79%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.