NPFFR2 Rabbit Polyclonal Antibody

CAT#: TA342654

Rabbit Polyclonal Anti-NPFFR2 Antibody

Product Images

WB Suggested Anti-NPFFR2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NPFFR2 antibody: synthetic peptide directed towards the C terminal of human NPFFR2. Synthetic peptide located within the following region: KAKSHVLINTSNQLVQESTFQNPHGETLLYRKSAEKPQQELVMEELKETT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: neuropeptide FF receptor 2
• Database Link:
  NP_444264
  Entrez Gene 10886 Human
  UniProt ID Q9Y5X5
• Background: This gene encodes a member of a subfamily of G-protein-coupled neuropeptide receptors. This protein is activated by the neuropeptides A-18-amide (NPAF) and F-8-amide (NPFF) and may function in pain modulation and regulation of the opioid system. Alternative splicing results in multiple transcript variants.
• Synonyms: GPR74; HLWAR77; NPFF2; NPGPR
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Neuroactive ligand-receptor interaction