RAP1GDS1 Rabbit Polyclonal Antibody

CAT#: TA342683

Rabbit Polyclonal Anti-RAP1GDS1 Antibody

Product Images

WB Suggested Anti-RAP1GDS1 Antibody; Titration: 1.0 ug/ml; Positive Control: Placenta

• 

  Host: Rabbit; Target Name: RAP1GDS1; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: RAP1GDS1; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: RAP1GDS1; Sample Tissue: Human Jurkat; Antibody Dilution: 1.0 ug/ml RAP1GDS1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RAP1GDS1 antibody: synthetic peptide directed towards the middle region of human RAP1GDS1. Synthetic peptide located within the following region: LLEIVQQKVDSDKEDDITELKTGSDLMVLLLLGDESMQKLFEGGKGSVFQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 61 kDa
• Gene Name: Rap1 GTPase-GDP dissociation stimulator 1
• Database Link:
  NP_001093899
  Entrez Gene 5910 Human
  UniProt ID P52306
• Background: The smg GDP dissociation stimulator (smgGDS) protein is a stimulatory GDP/GTP exchange protein with GTPase activity (Riess et al., 1993 [PubMed 8262526]).
• Synonyms: GDS1; SmgGDS
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Rabbit: 93%; Pig: 86%; Rat: 86%; Bovine: 86%; Mouse: 79%; Guinea pig: 79%