OR1L8 Rabbit Polyclonal Antibody

CAT#: TA342701

Rabbit Polyclonal Anti-OR1L8 Antibody

Product Images

WB Suggested Anti-OR1L8 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-OR1L8 antibody: synthetic peptide directed towards the C terminal of human OR1L8. Synthetic peptide located within the following region: MTEAPIVLVTRFLCIAFSYIRILTTVLKIPSTSGKRKAFSTCGFYLTVVT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: olfactory receptor family 1 subfamily L member 8
• Database Link:
  NP_001004454
  Entrez Gene 138881 Human
  UniProt ID Q8NGR8
• Background: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
• Synonyms: OR9-24
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Bovine: 93%; Horse: 92%; Mouse: 92%; Rabbit: 92%; Guinea pig: 92%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Olfactory transduction