GPRC5B Rabbit Polyclonal Antibody

CAT#: TA342742

Rabbit Polyclonal Anti-GPRC5B Antibody

Product Images

WB Suggested Anti-GPRC5B Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GPRC5B antibody: synthetic peptide directed towards the N terminal of human GPRC5B. Synthetic peptide located within the following region: AVAGAGALITLLLMLILLVRLPFIKEKEKKSPVGLHFLFLLGTLGLFGLT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: G protein-coupled receptor class C group 5 member B
• Database Link:
  NP_057319
  Entrez Gene 51704 Human
  UniProt ID Q9NZH0
• Background: The protein encoded by this gene is a member of the type 3 G protein-coupled receptor family. Members of this superfamily are characterized by a signature 7-transmembrane domain motif. The specific function of this protein is unknown; however, this protein may mediate the cellular effects of retinoic acid on the G protein signal transduction cascade.
• Synonyms: RAIG-2; RAIG2
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Horse: 86%; Bovine: 86%; Pig: 83%; Mouse

Reference Data

• Protein Families: Druggable Genome