CD200R (CD200R1) Rabbit Polyclonal Antibody

CAT#: TA342750

Rabbit Polyclonal Anti-CD200R1 Antibody

Product Images

WB Suggested Anti-CD200R1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CD200R1 antibody: synthetic peptide directed towards the N terminal of human CD200R1. Synthetic peptide located within the following region: NLIIITWEIILRGQPSCTKAYKKETNETKETNCTDERITWVSRPDQNSDL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: CD200 receptor 1
• Database Link:
  NP_620161
  Entrez Gene 131450 Human
  UniProt ID Q8TD46
• Background: This gene encodes a receptor for the OX-2 membrane glycoprotein. Both the receptor and substrate are cell surface glycoproteins containing two immunoglobulin-like domains. This receptor is restricted to the surfaces of myeloid lineage cells and the receptor-substrate interaction may function as a myeloid downregulatory signal. Mouse studies of a related gene suggest that this interaction may control myeloid function in a tissue-specific manner. Alternative splicing of this gene results in multiple transcript variants.
• Synonyms: CD200R; HCRTR2; MOX2R; OX2R
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Transmembrane