CNTF Receptor alpha (CNTFR) Rabbit Polyclonal Antibody

CAT#: TA342812

Rabbit Polyclonal Anti-CNTFR Antibody

Specifications

Product Data

• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CNTFR antibody: synthetic peptide directed towards the C terminal of human CNTFR. Synthetic peptide located within the following region: VAAHATPWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGELGSGG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: ciliary neurotrophic factor receptor
• Database Link:
  NP_001833
  Entrez Gene 1271 Human
  UniProt ID P26992
• Background: This gene encodes a hematopoeitin/interferon-class receptor belonging to the cytokine superfamily of receptors. The encoded gene product represents the CNTF-specific alpha subunit of a heterotrimer forming the CNTF receptor complex, which also includes LIFR and gp130. The receptor is attached to the membrane by a glycosyl-phosphatidylinositol linkage and contains an immunoglobulin-like C2-type domain and a fibronectin type-III domain. Signal transduction requires that CNTF bind first to this alpha component, which permits the recruitment of gp130 and LIFR beta to form the tripartite receptor complex. Signal transduction stimulates gene expression, cell survival or differentiation in a variety of neuronal cell types. Alternative splicing has been observed at this locus and two variants, both encoding the same protein, have been identified.
• Synonyms: MGC1774
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Sheep: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway