FAM126A Rabbit Polyclonal Antibody
Other products for "FAM126A"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-FAM126A antibody: synthetic peptide directed towards the C terminal of human FAM126A. Synthetic peptide located within the following region: MEISEVDEGFYSRAASSTSQSGLSNSSHNCSNKPSIGKNHRRSGGSKTGG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 57 kDa |
Gene Name | family with sequence similarity 126 member A |
Database Link | |
Background | FAM126A may play a part in the beta-catenin/Lef signaling pathway. Expression of FAM126A gene is down-regulated by beta-catenin. Defects in FAM126A gene are a cause of hypomyelination with congenital cataract (HCC). |
Synonyms | DRCTNNB1A; HCC; HLD5; HYCC1 |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 93%; Guinea pig: 93%; Horse: 86%; Rabbit: 86%; Rat: 85%; Mouse: 85%; Dog: 79%; Bovine: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.