MCEE Rabbit Polyclonal Antibody

CAT#: TA342914

Rabbit Polyclonal Anti-MCEE Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "MCEE"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MCEE antibody: synthetic peptide directed towards the C terminal of human MCEE. Synthetic peptide located within the following region: DSPIAGFLQKNKAGGMHHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAH
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 19 kDa
Gene Name methylmalonyl-CoA epimerase
Background MCEE catalyzes the interconversion of D- and L-methylmalonyl-CoA during the degradation of branched chain amino acids. odd chain-length fatty acids, and other metabolites. Mutations in this gene result in methylmalonyl-CoA epimerase deficiency, which is presented as mild to moderate methylmalonic aciduria.
Synonyms GLOD2
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Zebrafish: 100%; Mouse: 93%; Bovine: 93%; Guinea pig: 79%
Reference Data
Protein Pathways Metabolic pathways, Propanoate metabolism, Valine, leucine and isoleucine degradation

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.