MCEE Rabbit Polyclonal Antibody

CAT#: TA342914

Rabbit Polyclonal Anti-MCEE Antibody

Product Images

WB Suggested Anti-MCEE Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human brain

• 

  Hum. Fetal Brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MCEE antibody: synthetic peptide directed towards the C terminal of human MCEE. Synthetic peptide located within the following region: DSPIAGFLQKNKAGGMHHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 19 kDa
• Gene Name: methylmalonyl-CoA epimerase
• Database Link:
  NP_115990
  Entrez Gene 84693 Human
  UniProt ID Q96PE7
• Background: MCEE catalyzes the interconversion of D- and L-methylmalonyl-CoA during the degradation of branched chain amino acids. odd chain-length fatty acids, and other metabolites. Mutations in this gene result in methylmalonyl-CoA epimerase deficiency, which is presented as mild to moderate methylmalonic aciduria.
• Synonyms: GLOD2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Zebrafish: 100%; Mouse: 93%; Bovine: 93%; Guinea pig: 79%

Reference Data

• Protein Pathways: Metabolic pathways, Propanoate metabolism, Valine, leucine and isoleucine degradation