MNK1 (MKNK1) Rabbit Polyclonal Antibody

CAT#: TA342920

Rabbit Polyclonal Anti-MKNK1 Antibody

Product Images

WB Suggested Anti-MKNK1 Antibody; Titration: 1.0 ug/ml; Positive Control: A549 Whole Cell MKNK1 is supported by BioGPS gene expression data to be expressed in A549

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MKNK1 antibody: synthetic peptide directed towards the N terminal of human MKNK1. Synthetic peptide located within the following region: CQGNKNILELIEFFEDDTRFYLVFEKLQGGSILAHIQKQKHFNEREASRV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: MAP kinase interacting serine/threonine kinase 1
• Database Link:
  NP_003675
  Entrez Gene 8569 Human
  UniProt ID Q9BUB5
• Background: MKNK1 may play a role in the response to environmental stress and cytokines. It appears to regulate transcription by phosphorylating EIF4E, thus increasing the affinity of this protein for the 7-methylguanosine-containing mRNA cap.
• Synonyms: MNK1
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Mouse: 93%; Rabbit: 93%; Pig: 92%; Guinea pig: 92%; Horse: 86%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Insulin signaling pathway, MAPK signaling pathway