SPIRE2 Rabbit Polyclonal Antibody

CAT#: TA342930

Rabbit Polyclonal Anti-SPIRE2 Antibody

Product Images

WB Suggested Anti-SPIRE2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SPIRE2 antibody: synthetic peptide directed towards the N terminal of human SPIRE2. Synthetic peptide located within the following region: EAQTVQSLGFAIYRALDWGLDESEERELSPQLERLIDLMANNDSEDSGCG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 80 kDa
• Gene Name: spire type actin nucleation factor 2
• Database Link:
  NP_115827
  Entrez Gene 84501 Human
  UniProt ID Q8WWL2
• Background: SPIRE2 acts as a actin nucleation factor, remains associated with the slow-growing pointed end of the new filament. It is involved in vesicle transport processes providing a novel link between actin organization and intracellular transport .
• Synonyms: Spir-2
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Dog: 93%; Pig: 93%; Mouse: 93%; Zebrafish: 93%; Bovine: 86%; Rabbit: 86%

Reference Data

• Protein Pathways: Dorso-ventral axis formation