SPIRE2 Rabbit Polyclonal Antibody
Other products for "SPIRE2"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SPIRE2 antibody: synthetic peptide directed towards the N terminal of human SPIRE2. Synthetic peptide located within the following region: EAQTVQSLGFAIYRALDWGLDESEERELSPQLERLIDLMANNDSEDSGCG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 80 kDa |
Gene Name | spire type actin nucleation factor 2 |
Database Link | |
Background | SPIRE2 acts as a actin nucleation factor, remains associated with the slow-growing pointed end of the new filament. It is involved in vesicle transport processes providing a novel link between actin organization and intracellular transport . |
Synonyms | Spir-2 |
Note | Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Dog: 93%; Pig: 93%; Mouse: 93%; Zebrafish: 93%; Bovine: 86%; Rabbit: 86% |
Reference Data | |
Protein Pathways | Dorso-ventral axis formation |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.