ACBD6 Rabbit Polyclonal Antibody

CAT#: TA342937

Rabbit Polyclonal Anti-ACBD6 Antibody

Product Images

Host: Rabbit; Target Name: Acbd6; Sample Tissue: Rat Stomach lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Acbd6 antibody is: synthetic peptide directed towards the middle region of Rat Acbd6. Synthetic peptide located within the following region: SEKKGKEGSSGFGGPVVSSLYHEETIREEDKNIFDYCRENNIDHITKAIK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: acyl-CoA binding domain containing 6
• Database Link:
  NP_115736
  Entrez Gene 289125 Rat
  UniProt ID Q9BR61
• Background: Acbd6 binds long-chain acyl-coenzyme A molecules with a strong preference for unsaturated C18:1-CoA, lower affinity for unsaturated C20:4-CoA, and very weak affinity for saturated C16:0-CoA. It Does not bind fatty acids.
• Synonyms: MGC2404
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Zebrafish: 93%; Guinea pig: 93%; Bovine: 86%