VPS25 Rabbit Polyclonal Antibody

CAT#: TA342975

Rabbit Polyclonal Anti-VPS25 Antibody

Product Images

Host: Rabbit; Target Name: Vps25; Sample Tissue: Rat Pancreas lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Vps25 antibody is: synthetic peptide directed towards the C-terminal region of Rat Vps25. Synthetic peptide located within the following region: LYELTSGEDTEEEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 19 kDa
• Gene Name: vacuolar protein sorting 25 homolog
• Database Link:
  NP_115729
  Entrez Gene 681059 Rat
  UniProt ID Q9BRG1
• Background: Vps25 is a component of the ESCRT-II complex (endosomal sorting complex required for transport II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex. The ESCRT-II complex may also play a role in transcription regulation, possibly via its interaction with ELL.
• Synonyms: DERP9; EAP20; FAP20
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Pig: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Endocytosis