MASTL Rabbit Polyclonal Antibody

CAT#: TA343024

Rabbit Polyclonal Anti-MASTL Antibody

Product Images

WB Suggested Anti-MASTL Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MASTL antibody: synthetic peptide directed towards the C terminal of human MASTL. Synthetic peptide located within the following region: NKENIVNSFTDKQQTPEKLPIPMIAKNLMCELDEDCEKNSKRDYLSSSFL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 97 kDa
• Gene Name: microtubule associated serine/threonine kinase like
• Database Link:
  NP_116233
  Entrez Gene 84930 Human
  UniProt ID Q96GX5
• Background: This gene encodes a microtubule-associated serine/threonine kinase. Mutations at this locus have been associated with autosomal dominant thrombocytopenia, also known as thrombocytopenia-2. Alternatively spliced transcript variants have been described for this locus.
• Synonyms: GREATWALL; GW; GWL; MAST-L; THC2
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 86%; Dog: 82%; Pig: 79%; Horse: 79%; Bovine: 79%; Rat; Mouse; Guinea pig

Reference Data

• Protein Families: Druggable Genome, Protein Kinase