ACAD10 Rabbit Polyclonal Antibody

CAT#: TA343057

Rabbit Polyclonal Anti-ACAD10 Antibody

Product Images

Host: Rabbit; Target Name: ACAD10; Sample Tissue: MCF7 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ACAD10 antibody is: synthetic peptide directed towards the C-terminal region of Human ACAD10. Synthetic peptide located within the following region: LKEKAKAEGLWNLFLPLEADPEKKYGAGLTNVEYAHLCELMGTSLYAPEV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: acyl-CoA dehydrogenase family member 10
• Database Link:
  NP_079523
  Entrez Gene 80724 Human
  UniProt ID Q6JQN1
• Background: This gene encodes a member of the acyl-CoA dehydrogenase family of enzymes (ACADs), which participate in the beta-oxidation of fatty acids in mitochondria. The encoded enzyme contains a hydrolase domain at the N-terminal portion, a serine/threonine protein kinase catlytic domain in the central region, and a conserved ACAD domain at the C-terminus. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
• Synonyms: MGC5601
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 85%

Reference Data

• Protein Families: Druggable Genome