ACSF2 Rabbit Polyclonal Antibody

CAT#: TA343062

Rabbit Polyclonal Anti-ACSF2 Antibody

Product Images

WB Suggested Anti-ACSF2 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ACSF2 antibody: synthetic peptide directed towards the C terminal of human ACSF2. Synthetic peptide located within the following region: DLVVAYGTTENSPVTFAHFPEDTVEQKAESVGRIMPHTEARIMNMEAGTL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 68 kDa
• Gene Name: acyl-CoA synthetase family member 2
• Database Link:
  NP_079425
  Entrez Gene 80221 Human
  UniProt ID Q96CM8
• Background: Acyl-CoA synthases catalyze the initial reaction in fatty acid metabolism, by forming a thioester with CoA. ACSF2 has some preference toward medium-chain substrates. It plays a role in adipodyte differentiation.
• Synonyms: ACSMW; AVYV493
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Pig: 93%; Rabbit: 93%; Dog: 92%; Rat: 86%; Mouse: 86%; Guinea pig: 86%; Horse: 85%