ATCAY Rabbit Polyclonal Antibody

CAT#: TA343081

Rabbit Polyclonal Anti-ATCAY Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ATCAY"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ATCAY antibody: synthetic peptide directed towards the C terminal of human ATCAY. Synthetic peptide located within the following region: LIPMEHVQIPDCVLQYEEERLKARRESARPQPEFVLPRSEEKPEVAPVEN
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 42 kDa
Gene Name ataxia, cerebellar, Cayman type
Background This gene encodes a neuron-restricted protein that contains a CRAL-TRIO motif common to proteins that bind small lipophilic molecules. Mutations in this gene are associated with cerebellar ataxia, Cayman type.
Synonyms BNIP-H; CLAC
Note Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Yeast: 100%; Bovine: 100%; Dog: 93%; Rat: 93%; Guinea pig: 79%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.