Cathepsin S (CTSS) Rabbit Polyclonal Antibody

CAT#: TA343088

Rabbit Polyclonal Anti-CTSS Antibody

Product Images

WB Suggested Anti-CTSS Antibody; Titration: 1.0 ug/ml; Positive Control: Jurkat Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CTSS antibody: synthetic peptide directed towards the N terminal of human CTSS. Synthetic peptide located within the following region: QLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: cathepsin S
• Database Link:
  NP_004070
  Entrez Gene 1520 Human
  UniProt ID P25774
• Background: The protein encoded by this gene, a member of the peptidase C1 family, is a lysosomal cysteine proteinase that may participate in the degradation of antigenic proteins to peptides for presentation on MHC class II molecules. The encoded protein can function as an elastase over a broad pH range in alveolar macrophages. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
• Synonyms: FLJ50259; MGC3886
• Note: Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%; Rat: 86%

Reference Data

• Protein Families: Druggable Genome, Protease
• Protein Pathways: Antigen processing and presentation, Lysosome