DHH Rabbit Polyclonal Antibody

CAT#: TA343152

Rabbit Polyclonal Anti-DHH Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Dhh antibody is: synthetic peptide directed towards the N-terminal region of Mouse Dhh. Synthetic peptide located within the following region: FRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 43 kDa
Gene Name desert hedgehog
Background Dhh is an intercellular signal essential for a variety of patterning events during development. It may function as a spermatocyte survival factor in the testes and it is essential for testes development.
Synonyms GDXYM; HHG-3; SRXY7
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Goat: 93%; Sheep: 93%; Rabbit: 93%; Zebrafish: 93%
Reference Data
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Protease
Protein Pathways Hedgehog signaling pathway

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.