SPECC1 Rabbit Polyclonal Antibody
Other products for "SPECC1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SPECC1 antibody is: synthetic peptide directed towards the N-terminal region of Human SPECC1. Synthetic peptide located within the following region: RTPSTKPKQENEGGEKAALESQVRELLAEAKAKDSEINRLRSELKKYKEK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 87 kDa |
Gene Name | sperm antigen with calponin homology and coiled-coil domains 1 |
Database Link | |
Background | The protein encoded by this gene belongs to the cytospin-A family. It is localized in the nucleus, and highly expressed in testis and some cancer cell lines. A chromosomal translocation involving this gene and platelet-derived growth factor receptor, beta gene (PDGFRB) may be a cause of juvenile myelomonocytic leukemia. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. |
Synonyms | CYTSB; HCMOGT-1; HCMOGT1; NSP |
Note | Immunogen Sequence Homology: Human: 100%; Rabbit: 87%; Dog: 79%; Rat: 79%; Horse: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.