SPECC1 Rabbit Polyclonal Antibody

CAT#: TA343199

Rabbit Polyclonal Anti-SPECC1 Antibody

Product Images

WB Suggested Anti-SPECC1 Antibody; Titration: 1.0 ug/ml; Positive Control: HepG2 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SPECC1 antibody is: synthetic peptide directed towards the N-terminal region of Human SPECC1. Synthetic peptide located within the following region: RTPSTKPKQENEGGEKAALESQVRELLAEAKAKDSEINRLRSELKKYKEK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 87 kDa
• Gene Name: sperm antigen with calponin homology and coiled-coil domains 1
• Database Link:
  NP_690868
  Entrez Gene 92521 Human
  UniProt ID Q5M775
• Background: The protein encoded by this gene belongs to the cytospin-A family. It is localized in the nucleus, and highly expressed in testis and some cancer cell lines. A chromosomal translocation involving this gene and platelet-derived growth factor receptor, beta gene (PDGFRB) may be a cause of juvenile myelomonocytic leukemia. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
• Synonyms: CYTSB; HCMOGT-1; HCMOGT1; NSP
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 87%; Dog: 79%; Rat: 79%; Horse: 79%