IFNK Rabbit Polyclonal Antibody

CAT#: TA343221

Rabbit Polyclonal Anti-IFNK Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "IFNK"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-IFNK antibody is: synthetic peptide directed towards the C-terminal region of Human IFNK. Synthetic peptide located within the following region: MKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSDCAWEIVRVEIRRCLYY
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 22 kDa
Gene Name interferon kappa
Background This gene encodes a member of the type I interferon family. Type I interferons are a group of related glycoproteins that play an important role in host defenses against viral infections. This protein is expressed in keratinocytes and the gene is found on chromosome 9, adjacent to the type I interferon cluster.
Synonyms IFNT1; INFE1
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Pig: 92%; Sheep: 85%; Bovine: 85%; Guinea pig: 85%; Rat; Goat
Reference Data
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway, RIG-I-like receptor signaling pathway

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.