ARHGEF1 Rabbit Polyclonal Antibody

CAT#: TA343288

Rabbit Polyclonal Anti-ARHGEF1 Antibody

Product Images

WB Suggested Anti-ARHGEF1 Antibody; Titration: 1.0 ug/ml; Positive Control: Jurkat Whole Cell ARHGEF1 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ARHGEF1 antibody is: synthetic peptide directed towards the N-terminal region of Human ARHGEF1. Synthetic peptide located within the following region: SAAVVNAIGLYMRHLGVRTKSGDKKSGRNFFRKKVMGNRRSDEPAKTKKG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 102 kDa
• Gene Name: Rho guanine nucleotide exchange factor 1
• Database Link:
  NP_945353
  Entrez Gene 9138 Human
  UniProt ID Q92888
• Background: Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form complex with G proteins and stimulate Rho-dependent signals. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.
• Synonyms: GEF1; LBCL2; LSC; P115-RHOGEF; SUB1.5
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Pig: 86%; Horse: 86%

Reference Data

• Protein Pathways: Regulation of actin cytoskeleton, Vascular smooth muscle contraction