TAL2 Rabbit Polyclonal Antibody

CAT#: TA343537

Rabbit Polyclonal Anti-TAL2 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "TAL2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TAL2 antibody: synthetic peptide directed towards the N terminal of human TAL2. Synthetic peptide located within the following region: TRKIFTNTRERWRQQNVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYI
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 12 kDa
Gene Name T-cell acute lymphocytic leukemia 2
Background TAL2 is a helix-loop-helix protein. Translocations between this gene on chromosome 9 and the T-cell receptor beta-chain locus on chromosome 7 have been associated with activation of the T-cell acute lymphocytic leukemia 2 gene and T-cell acute lymphoblastic leukemia.
Synonyms bHLHa19; T-cell acute lymphocytic leukemia 2
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Rat: 93%; Horse: 93%; Mouse: 92%; Rabbit: 92%; Zebrafish: 92%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.