ZNF192 (ZKSCAN8) Rabbit Polyclonal Antibody

CAT#: TA343599

Rabbit Polyclonal Anti-ZNF192 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ZKSCAN8"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF192 antibody: synthetic peptide directed towards the N terminal of human ZNF192. Synthetic peptide located within the following region: MAEESRKPSAPSPPDQTPEEDLVIVKVEEDHGWDQESSLHESNPLGQEVF
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 66 kDa
Gene Name zinc finger with KRAB and SCAN domains 8
Background ZNF192 belongs to the krueppel C2H2-type zinc-finger protein family and contains the conserved SCAN box domain. ZNF192 may be involved in transcriptional regulation.
Synonyms LD5-1; ZNF192; ZSCAN40
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Goat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 93%; Guinea pig: 93%; Rat: 86%; Mouse: 79%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.