NCOA2 Rabbit Polyclonal Antibody

CAT#: TA343620

Rabbit Polyclonal Anti-NCOA2 Antibody

Product Images

WB Suggested Anti-NCOA2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Thymus

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NCOA2 antibody: synthetic peptide directed towards the N terminal of human NCOA2. Synthetic peptide located within the following region: MSGMGENTSDPSRAETRKRKECPDQLGPSPKRNTEKRNREQENKYIEELA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 159 kDa
• Gene Name: nuclear receptor coactivator 2
• Database Link:
  NP_006531
  Entrez Gene 83724 RatEntrez Gene 10499 Human
  UniProt ID Q15596
• Background: NCOA2 is the transcriptional coactivator for steroid receptors and nuclear receptors. NCOA2 is the coactivator of the steroid binding domain (AF-2) but not of the modulating N-terminal domain (AF-1). NCOA2 is required with NCOA1 to control energy balance
• Synonyms: bHLHe75; GRIP1; KAT13C; NCoA-2; SRC2; TIF2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Bovine: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome