Hoxc9 Rabbit Polyclonal Antibody

CAT#: TA343642

Rabbit Polyclonal Anti-Hoxc9 Antibody

Product Images

WB Suggested Anti-Hoxc9 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Testis

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Hoxc9 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hoxc9. Synthetic peptide located within the following region: EFLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKKMNKEKTDKEQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: homeobox C9
• Database Link:
  NP_032298
  Entrez Gene 15427 Mouse
  UniProt ID P09633
• Background: Hoxc9 is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
• Synonyms: Hox-3B; HOX3; HOX3B
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 87%