ZBTB25 Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of zinc finger and BTB domain containing 25 (ZBTB25)
USD 396.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 159.00
Other products for "ZBTB25"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZBTB25 antibody: synthetic peptide directed towards the middle region of human ZBTB25. Synthetic peptide located within the following region: GNALAQRFQPYCDSWSDVSLKSSRLSQEHLDLPCALESELTQENVDTILV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 49 kDa |
Gene Name | zinc finger and BTB domain containing 25 |
Database Link | |
Background | ZBTB25 contains 1 BTB (POZ) domain and 2 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. ZBTB25 may be involved in transcriptional regulation. |
Synonyms | C14orf51; KUP; ZNF46 |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 92%; Horse: 92%; Mouse: 92%; Dog: 79%; Bovine: 79% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.