KAT7 Rabbit Polyclonal Antibody
Frequently bought together (2)
Other products for "KAT7"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MYST2 antibody: synthetic peptide directed towards the N terminal of human MYST2. Synthetic peptide located within the following region: PRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQ |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 71 kDa |
Gene Name | lysine acetyltransferase 7 |
Database Link | |
Background | MYST2 belongs to the MYST family, which is characterized by a highly conserved C2HC zinc finger and a putative histone acetyltransferase domain. MYST2 specifically represses AR-mediated transcription. MYST2 is a new AR-interacting protein capable of modulating AR activity. It could play a significant role in regulating AR-dependent genes in normal and prostate cancer cells. The biochemical and genetic interactions of MYST family protein MYST2 with two components of the replication apparatus, MCM2 and ORC1, suggest that MYST2-associated HAT activity may play a direct role in the process of DNA replication. MYST2 is a positive regulatory factor for prereplicative complex assembly. |
Synonyms | HBO1; HBOA; MYST2; ZC2HC7 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.