GTL3 (CFAP20) Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human chromosome 16 open reading frame 80 (C16orf80)
USD 823.00
Transient overexpression lysate of chromosome 16 open reading frame 80 (C16orf80)
USD 396.00
Other products for "CFAP20"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-C16orf80 antibody: synthetic peptide directed towards the middle region of human C16orf80. Synthetic peptide located within the following region: AYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 23 kDa |
Gene Name | cilia and flagella associated protein 20 |
Database Link | |
Background | The specific function of C16orf80 is not yet known. |
Synonyms | C16orf80; EVORF; fSAP23; GTL3 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 93% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.