Hoxd9 Rabbit Polyclonal Antibody

CAT#: TA343721

Rabbit Polyclonal Anti-Hoxd9 Antibody


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "Hoxd9"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Rat
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Hoxd9 antibody is: synthetic peptide directed towards the N-terminal region of Rat Hoxd9. Synthetic peptide located within the following region: MSSSGTLSNYYVDSLIGHEGDEVFAARFGPPGPGTQGRPAGVADGPAAAA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 37 kDa
Gene Name homeo box D9
Background Hoxd9 is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Synonyms Hox-4.3; Hox-4C; Hox-5.2; HOX4; HOX4C
Note Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Rabbit: 86%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.