RBM47 Rabbit Polyclonal Antibody

CAT#: TA343889

Rabbit Polyclonal Anti-RBM47 Antibody

Product Images

WB Suggested Anti-RBM47 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1: 62500 Positive Control: NCI-H226

• 

  Host: Rabbit; Target Name: RBM47; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: RBM47; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: RBM47; Sample Tissue: Human Fetal Liver; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: RBM47; Sample Tissue: Human Fetal Muscle; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: RBM47; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• human Colon

Show all 7 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RBM47 antibody: synthetic peptide directed towards the middle region of human RBM47. Synthetic peptide located within the following region: HFTSREDAVHAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKAARGGGA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: RNA binding motif protein 47
• Database Link:
  NP_061900
  Entrez Gene 54502 Human
  UniProt ID A0AV96
• Background: The function of this protein remains unknown.
• Synonyms: NET18
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%