PAPOLB Rabbit Polyclonal Antibody

CAT#: TA343891

Rabbit Polyclonal Anti-PAPOLB Antibody

Product Images

WB Suggested Anti-PAPOLB Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: OVCAR-3 cell lysate; PAPOLB is supported by BioGPS gene expression data to be expressed in OVCAR3

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PAPOLB antibody: synthetic peptide directed towards the N terminal of human PAPOLB. Synthetic peptide located within the following region: TDCLLTQRLIETLRPFGVFEEEEELQRRILVLEKLNNLVKEWIREISESK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 72 kDa
• Gene Name: poly(A) polymerase beta
• Database Link:
  NP_064529
  Entrez Gene 56903 Human
  UniProt ID Q9NRJ5
• Background: The function of this protein remains unknown.
• Synonyms: PAPT; TPAP
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Dog: 92%; Pig: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Zebrafish: 92%; Guinea pig: 92%; Bovine: 85%

Reference Data

• Protein Pathways: RNA degradation