MIF4GD Rabbit Polyclonal Antibody

CAT#: TA343899

Rabbit Polyclonal Anti-MIF4GD Antibody

Product Images

WB Suggested Anti-MIF4GD Antibody Titration: 1.25 ug/ml; Positive Control: HepG2 cell lysate

• 

  Rabbit Anti-MIF4GD Antibody; Paraffin Embedded Tissue: Human Kidney; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MIF4GD antibody: synthetic peptide directed towards the C terminal of human MIF4GD. Synthetic peptide located within the following region: LFVLIRDGFLLPTGLSSLAQLLLLEIIEFRAAGWKTTPAAHKYYYSEVSD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: MIF4G domain containing
• Database Link:
  NP_065730
  Entrez Gene 57409 Human
  UniProt ID A9UHW6
• Background: MIF4GD is a protein which contains an MIF4G domain.This gene encodes a protein which contains an MIF4G domain.
• Synonyms: AD023; MIFD; SLIP1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%