NXF5 Rabbit Polyclonal Antibody

CAT#: TA343956

Rabbit Polyclonal Anti-NXF5 Antibody

Product Images

WB Suggested Anti-NXF5 Antibody Titration: 2.5 ug/ml; Positive Control: Jurkat cell lysate

• 

  Lanes: Lane 1: 7ug HeLa cystosolic extract; Lane 2: 7ug HeLa nuclear extract; Primary Antibody Dilution: 1: 100; Secondary Antibody: Anti-rabbit-HRP; Secondary Antibody Dilution: 1: 500; Gene Name: NXF5;

• 

  Rabbit Anti-NXF5 Antibody; Paraffin Embedded Tissue: Human Kidney; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

• 

  Rabbit Anti-NXF5 Antibody; Paraffin Embedded Tissue: Human Intestine; Cellular Data: Epithelial cells of intestinal villas; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NXF5 antibody: synthetic peptide directed towards the middle region of human NXF5. Synthetic peptide located within the following region: ITERNFPELLSLNLCNNKLYQLDGLSDITEKAPKVKTLNLSKNKLESAWE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: nuclear RNA export factor 5
• Database Link:
  NP_116564
  Entrez Gene 55998 Human
  UniProt ID Q9H1B4
• Background: NXF5 is one member of a family of nuclear RNA export factors. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity.This gene is one member of a family of nuclear RNA export factor genes. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. Alternative splicing seems to be a common mechanism in this gene family. Five transcript variants that encode different isoforms have been found for this gene.
• Synonyms: TAPL-1; TAPL1
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Rat: 86%; Rabbit: 86%; Mouse: 79%