ADAD2 Rabbit Polyclonal Antibody

CAT#: TA343988

Rabbit Polyclonal Anti-ADAD2 Antibody

Product Images

WB Suggested Anti-ADAD2 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ADAD2 antibody: synthetic peptide directed towards the middle region of human ADAD2. Synthetic peptide located within the following region: GQQLHDCHGLVIARRALLRFLFRQLLLATQGGPKGKEQSVLAPQPGPGPP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 71 kDa
• Gene Name: adenosine deaminase domain containing 2
• Database Link:
  NP_631913
  Entrez Gene 161931 Human
  UniProt ID Q8NCV1
• Background: ADAD2 belongs to the ADAD family, and contains 1 A to I editase domain and 1 DRBM (double-stranded RNA-binding) domain. The exact functions of ADAD2 remain unknown.
• Synonyms: TENRL
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 93%; Pig: 86%; Rat: 86%; Bovine: 86%; Rabbit: 86%; Dog: 79%; Mouse: 79%