DCP2 Rabbit Polyclonal Antibody

CAT#: TA344009

Rabbit Polyclonal Anti-DCP2 Antibody

Product Images

WB Suggested Anti-DCP2 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate; DCP2 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DCP2 antibody: synthetic peptide directed towards the C terminal of human DCP2. Synthetic peptide located within the following region: VEKLSRTKFRHSQQLFPDGSPGDQWVKHRQPLQQKPYNNHSEMSDLLKGK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: decapping mRNA 2
• Database Link:
  NP_689837
  Entrez Gene 167227 Human
  UniProt ID Q8IU60
• Background: DCP2 is necessary for the degradation of mRNAs, both in normal mRNA turnover and in nonsense-mediated mRNA decay. DCP2 removes the 7-methyl guanine cap structure from mRNA molecules, yielding a 5'-phosphorylated mRNA fragment and 7m-GDP. It has higher activity towards mRNAs that lack a poly(A) tail, but has no activity towards a cap structure lacking a RNA moiety.DCP2 is a key component of an mRNA-decapping complex required for removal of the 5-prime cap from mRNA prior to its degradation from the 5-prime end (Fenger-Gron et al., 2005 [PubMed 16364915]). [supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-539 AY135173.1 1-539 540-1992 AK090564.1 481-1933 1993-8947 AC008536.7 154323-161277
• Synonyms: NUDT20
• Note: Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Dog: 93%; Rat: 86%; Bovine: 86%; Guinea pig: 86%; Mouse: 79%

Reference Data

• Protein Pathways: RNA degradation