WDR9 (BRWD1) Rabbit Polyclonal Antibody

CAT#: TA344091

Rabbit Polyclonal Anti-BRWD1 Antibody

Product Images

WB Suggested Anti-BRWD1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: PANC1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BRWD1 antibody: synthetic peptide directed towards the N terminal of human BRWD1. Synthetic peptide located within the following region: MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 13 kDa
• Gene Name: bromodomain and WD repeat domain containing 1
• Database Link:
  NP_001007247
  Entrez Gene 54014 Human
  UniProt ID Q9NSI6
• Background: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein com
• Synonyms: C21orf107; DCAF19; N143; WDR9
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 92%; Dog: 86%