EIF2AK1 Rabbit Polyclonal Antibody

CAT#: TA344094

Rabbit Polyclonal Anti-EIF2AK1 Antibody

Product Images

WB Suggested Anti-EIF2AK1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human Lung

• 

  Host: Rabbit; Target Name: EIF2AK1; Sample Tissue: Human Hela; Antibody Dilution: 1.0 ug/ml; EIF2AK1 is strongly supported by BioGPS gene expression data to be expressed in HeLa

• 

  Host: Rabbit; Target Name: EIF2AK1; Sample Tissue: Human 293T; Antibody Dilution: 1.0 ug/ml; EIF2AK1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EIF2AK1 antibody: synthetic peptide directed towards the N terminal of human EIF2AK1. Synthetic peptide located within the following region: TCSDEFSSLRLHHNRAITHLMRSAKERVRQDPCEDISRIQKIRSREVALE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 71 kDa
• Gene Name: eukaryotic translation initiation factor 2 alpha kinase 1
• Database Link:
  NP_055228
  Entrez Gene 27102 Human
  UniProt ID Q9BQI3
• Background: EIF2AK1 acts at the level of translation initiation to downregulate protein synthesis in response to stress. The protein is a kinase that can be inactivated by hemin. Two transcript variants encoding different isoforms have been found for this gene.The HRI gene is localized to 7p22 where its 3' end slightly overlaps the 3' end of the gene JTV1. The two genes are transcribed from opposite strands. Studies in rat and rabbit suggest that the HRI gene product phosphorylates the alpha subunit of eukaryotic initiation factor 2. Its kinase activity is induced by low levels of heme and inhibited by the presence of heme. Sequence Note: The sequence AF181071.1 is a chimeric mRNA clone. Only the heme-regulated initiation factor 2-alpha kinase region was propagated into this RefSeq record.
• Synonyms: HCR; HRI
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase