Asporin (ASPN) Rabbit Polyclonal Antibody

CAT#: TA344139

Rabbit Polyclonal Anti-ASPN Antibody


USD 410.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "ASPN"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ASPN antibody: synthetic peptide directed towards the middle region of human ASPN. Synthetic peptide located within the following region: NKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENNK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 42 kDa
Gene Name asporin
Background ASPN belongs to a family of leucine-rich repeat (LRR) proteins associated with the cartilage matrix. The name asporin reflects the unique aspartate-rich N terminus and the overall similarity to decorin.ASPN belongs to a family of leucine-rich repeat (LRR) proteins associated with the cartilage matrix. The name asporin reflects the unique aspartate-rich N terminus and the overall similarity to decorin (MIM 125255) (Lorenzo et al., 2001). [supplied by OMIM]
Synonyms OS3; PLAP-1; PLAP1; SLRR1C
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Pig: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Zebrafish: 90%; Dog: 86%; Rabbit: 86%; Guinea pig: 86%
Reference Data
Protein Families Secreted Protein

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.