DCUN1D1 Rabbit Polyclonal Antibody

CAT#: TA344174

Rabbit Polyclonal Anti-DCUN1D1 Antibody


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Recombinant protein of human DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae) (DCUN1D1)
    • 20 ug

USD 823.00


Transient overexpression lysate of DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae) (DCUN1D1)
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "DCUN1D1"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-DCUN1D1 antibody: synthetic peptide directed towards the N terminal of human DCUN1D1. Synthetic peptide located within the following region: SQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 28 kDa
Gene Name defective in cullin neddylation 1 domain containing 1
Background DCUN1D1 may contribute to neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes. Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity.
Synonyms DCNL1; DCUN1L1; RP42; SCCRO; SCRO; Tes3
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.