Argonaute 4 (AGO4) Rabbit Polyclonal Antibody

CAT#: TA344200

Rabbit Polyclonal Anti-EIF2C4 Antibody - middle region

Product Images

WB Suggested Anti-EIF2C4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EIF2C4 antibody: synthetic peptide directed towards the middle region of human EIF2C4. Synthetic peptide located within the following region: DGHPSRYCATVRVQTSRQEISQELLYSQEVIQDLTNMVRELLIQFYKSTR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 95 kDa
• Gene Name: argonaute 4, RISC catalytic component
• Database Link:
  NP_060099
  Entrez Gene 192670 Human
  UniProt ID Q9HCK5
• Background: This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic containing PAZ and PIWI domains, and it may play a role in short-interfering-RNA-mediated gene silencing. This gene i
• Synonyms: EIF2C4
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%

Reference Data

• Protein Families: Druggable Genome