CDKL2 Rabbit Polyclonal Antibody

CAT#: TA344268

Rabbit Polyclonal Anti-CDKL2 Antibody - N-terminal region

Product Images

WB Suggested Anti-CDKL2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: SH-SYSY cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CDKL2 antibody: synthetic peptide directed towards the N terminal of human CDKL2. Synthetic peptide located within the following region: MEKYENLGLVGEGSYGMVMKCRNKDTGRIVAIKKFLESDDDKMVKKIAMR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: cyclin dependent kinase like 2
• Database Link:
  NP_003939
  Entrez Gene 8999 Human
  UniProt ID Q92772
• Background: The specific function of the protein remains unknown.This gene product is a member of a large family of CDC2-related serine/threonine protein kinases. It accumulates primarily in the cytoplasm, with lower levels in the nucleus.
• Synonyms: KKIAMRE; P56
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase